PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_60976.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 57aa    MW: 6638.57 Da    PI: 4.2669
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_60976.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM62.81.1e-191257248
                      NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                             ppGfrFhPtdeelv +yLkkkv++++++l +vi+e+d+yk+ePwdL+
  Rsa1.0_60976.1_g00001.1 12 PPGFRFHPTDEELVGYYLKKKVASQSIDL-DVIREIDLYKIEPWDLQ 57
                             9****************************.9**************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-19756IPR003441NAC domain
PROSITE profilePS5100521.8831157IPR003441NAC domain
PfamPF023659.5E-101254IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 57 aa     Download sequence    Send to blast
MMGPVDQESS IPPGFRFHPT DEELVGYYLK KKVASQSIDL DVIREIDLYK IEPWDLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-166561060Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382787e-80KF738278.1 Brassica napus NAC transcription factor 105 (NAC105.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596224.19e-34PREDICTED: NAC domain-containing protein 105 isoform X2
RefseqXP_013651709.19e-34PREDICTED: NAC domain-containing protein 105-like isoform X1
RefseqXP_013596223.19e-34PREDICTED: NAC domain-containing protein 105 isoform X1
SwissprotO655086e-29NAC76_ARATH; NAC domain-containing protein 76
TrEMBLA0A078H1T91e-33A0A078H1T9_BRANA; BnaC07g16780D protein
TrEMBLA0A0D3D8I41e-33A0A0D3D8I4_BRAOL; Uncharacterized protein
STRINGBra012065.1-P5e-31(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36160.13e-30NAC domain containing protein 76